PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462926302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 1227aa    MW: 136312 Da    PI: 10.2838
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462926302genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.67.4e-16393483195
                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                ++k+ +++++l++  l l   f++++g+ +++++tl+    s++sW+v  + + k ++y l++GWk+F+ +n+L+ gD+++F++++  ++  +v 
  462926302 393 WIKKQINPNALAKE-LALATAFCDAIGLREHCTVTLKTSMDSSESWQVLGS-KIKNKSYRLGQGWKKFCLDNNLELGDICTFSVVE--TTVWHVD 483
                67889999999998.**************99988888777999*******5.444456*************************655..3333555 PP

2B350.34.4e-165666471295
                HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                ++++ +l  +f+e++g+++++ +tl+  ++s + W+ ++i  k+s+++v + GWk+F+++ng+k gD+++F  ++++e   +v+
  462926302 566 SLSMQYLAPEFCEAIGIQEPCIITLKTSTSSTKAWQTRVIPYKNSSHHVGGLGWKSFCQENGIKLGDVCTFNIVETTEW--HVT 647
                55667899*************99999999999*******99*******************************7765444..443 PP

3B3383e-1298210521586
                 -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldg 86  
                  l lp +f++++g+++++++tl+    s  sW v    r + +  y +++GW++  k+n L egD+++F +++
  462926302  982 YLALPISFCDAIGLQETCTITLKTSMNSIGSWLVHG--RPYENNsYKFARGWRRSSKDNCLGEGDICTFLVVK 1052
                 589************99976666666777*******..66655559***********************9654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.9E-854132IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-755132IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.03494132IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-12224324IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.137226322IPR003340B3 DNA binding domain
SuperFamilySSF1019369.02E-14227324IPR015300DNA-binding pseudobarrel domain
CDDcd100171.09E-8229319No hitNo description
SMARTSM010197.4E-5229322IPR003340B3 DNA binding domain
SuperFamilySSF1019367.65E-17388487IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-17391488IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.2E-5394488IPR003340B3 DNA binding domain
PfamPF023624.0E-11395476IPR003340B3 DNA binding domain
CDDcd100171.20E-9407472No hitNo description
PROSITE profilePS5086311.575424488IPR003340B3 DNA binding domain
PROSITE profilePS5086311.138555652IPR003340B3 DNA binding domain
SMARTSM010190.0021557654IPR003340B3 DNA binding domain
CDDcd100173.56E-10562636No hitNo description
PfamPF023621.6E-13566648IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.7E-16566651IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.55E-14568653IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.055678768IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-7688770IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-8689770IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.837730768IPR003340B3 DNA binding domain
SuperFamilySSF1019365.69E-13792891IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-13792891IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.698792889IPR003340B3 DNA binding domain
SMARTSM010190.0012795889IPR003340B3 DNA binding domain
PROSITE profilePS5086310.2369681064IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.9E-129701062IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.099721064IPR003340B3 DNA binding domain
SuperFamilySSF1019361.2E-129771063IPR015300DNA-binding pseudobarrel domain
PfamPF023621.3E-89821059IPR003340B3 DNA binding domain
CDDcd100171.52E-69831062No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1227 aa     Download sequence    Send to blast
MASFGRSGTA VARKHLRVLL PFFRKSLVRA TPSAAVAPRK KSPARGTNLP CISQRIPDEL  60
AEDIGAAEAH VEIPFGKGKV RRRVEVGRDG DGAFLGRGWK EFAAACGVGA GWLLVLRHRG  120
GGVLTVKAFD DSGWVVAAAC GVGAGWLLVL RHRGGGVLTV KAFDDSGCFR ELGSPPPAGK  180
DSTFSSRGVN FSIIFPPVNE FRTDRSKSQL YCSAEVTTSS KDATRRLQFI SVLSQDSLTK  240
MLLPSMFVRQ CIPNEGLNTL KVIVFGPLGK VYPIGLEMNQ SDLFFAGGWS QFLAFHGITE  300
ANVLLLRYEA NMVFTVKVFT ADGCQMESKH KDIKMQQCDD ERQQAISVAS WKCKSKNNWP  360
SSEEQKKPTG SMTSLPKSPL LMKSIYEIGP PSWIKKQINP NALAKELALA TAFCDAIGLR  420
EHCTVTLKTS MDSSESWQVL GSKIKNKSYR LGQGWKKFCL DNNLELGDIC TFSVVETTVW  480
HVDVTRSKEK IKQFRYVNPS TSSSKRMSNI NRSSRKGKNR PKGSRTYLNK ALSKTKCVVE  540
IGPPAWIKKE INTCAINNKL VSTIISLSMQ YLAPEFCEAI GIQEPCIITL KTSTSSTKAW  600
QTRVIPYKNS SHHVGGLGWK SFCQENGIKL GDVCTFNIVE TTEWHVTITC SRRSLGGSPP  660
SSWAMPPSGD HGGAKVEHLR VLLPFSRGSL RIPDALAAEI GAGEALVVGP SVGKVNFHRV  720
EVGRDGDGAF LGRGWPEFAA ACGVGAGWLL VLRHRGRGVL TVKAFDASCC LKELGTSAPP  780
AATVINKEAP HRLQFISVLR KDSMKKMSIP ATVVQHYMPK EQPNNNSTAI FLGPLCKVWH  840
IDLEMNQSDV FFVGRWSQFL AFHGITEANA LLLRYKGNMV FKIKVFESDG CQRESKLRDI  900
QIQQPLRDIE EQKRAPSASI QKRKIKDNWP GEKRKKPKCF MISSNKASSQ WKTVYEIGPP  960
SWIRKHVNTN TLQNQLVRTA IYLALPISFC DAIGLQETCT ITLKTSMNSI GSWLVHGRPY  1020
ENNSYKFARG WRRSSKDNCL GEGDICTFLV VKTTLWHVVI TRYHEKINHL CNLESPFVSS  1080
RKYKSKNDWR SSEGQKTQEG SMTLNKASLQ TKCVFEIGPP SSIKKMTNTT NTLENTLVHC  1140
RKMKGGKEQK DAKAKKQVQL PEEEQLQIRK RCAGRTWCRL FGDRGWKKFC KENGLKAQGM  1200
APAPSISEVE TVWWHVGITK LGQRYQT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1921935KRKIKDNWPGEKRKK
2921937KRKIKDNWPGEKRKKPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-140PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9S1931e-177A0A0A9S193_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-09B3 family protein